Web Analysis for Kansascityindependentfinancialadvisor - kansascityindependentfinancialadvisor.com
Beacon Financial Advisors is a fee only financial planning firm located in Lee's Summit, MO.
kansascityindependentfinancialadvisor.com is 9 years 9 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, kansascityindependentfinancialadvisor.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 2 | H2 Headings: | 3 |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 1 |
Google Adsense: | Not Applicable | Google Analytics: | UA-25536070-1 |
Websites Hosted on Same IP (i.e. 50.63.202.1)
Tamilcnn - Tamil News - Tamil Cinema - Tamil Songs - தமிழர் செய்திகளின் முதல்வன்
நடுநிலையாய் தமிழில் செய்திகளை முந்தித் தருவதில் முதல்வன் தமிழ் சிஎன்என். இலங்கை, இந்தியா, கனடா, சுவிஸ் மற்றும் உலகச் செய்திகள். சினிமா, தொழிநுட்பம், விளையாட்டு, மருத்துவம் மற்றும் தமிழர் நிகழ்வுகள் அனைத்தம் ஒரே இடத்தில்..
Market Connect - Better Qualified Multifamily Prospects - MRI Software
Market Connect - an unbeatable lineup of pricing and availability, property and mobile websites which allows you to leverage data directly from your system.
Deb Augur WordPress Developer | NOT Just Another WordPress Developer!
Wholesale Boutique Clothing | Wholesale Pricing With $50 Minimum Order
Katydid Wholesale sells wholesale boutique clothing with a low order minimum of just $50. Check out our collection today and pick up some hats, tees, and more!
InvestAsian | Buy Property & Stocks in Asia | Skip the Next Recession
InvestAsian helps you buy property & other assets in Asia's best economies. Frontier markets like Vietnam, Cambodia & the Philippines even avoid recession.
HTTP Header Analysis
Date: Mon, 25 Aug 2014 04:26:56 GMT
Server: Apache
X-Powered-By: PHP/5.3.28
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://www.beacon-advisor.com/xmlrpc.php
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns51.domaincontrol.com | 97.74.105.26 | United States of America | |
ns52.domaincontrol.com | 173.201.73.26 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
kansascityindependentfinancialadvisor.com | A | 3599 |
IP: 50.63.202.1 |
kansascityindependentfinancialadvisor.com | NS | 3599 |
Target: ns52.domaincontrol.com |
kansascityindependentfinancialadvisor.com | NS | 3599 |
Target: ns51.domaincontrol.com |
kansascityindependentfinancialadvisor.com | SOA | 3599 |
MNAME: ns51.domaincontrol.com RNAME: dns.jomax.net Serial: 2014081701 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 600 |
kansascityindependentfinancialadvisor.com | MX | 3599 |
Priority: 10 Target: mailstore1.secureserver.net |
kansascityindependentfinancialadvisor.com | MX | 3599 |
Target: smtp.secureserver.net |
Full WHOIS Lookup
Registrar URL: http://www.wildwestdomains.com
Registrant Name: Kristine McKinley
Registrant Organization: Beacon Financial Advisors, LLC
Name Server: NS51.DOMAINCONTROL.COM
Name Server: NS52.DOMAINCONTROL.COM
DNSSEC: unsigned
For complete domain details go to:
http://who.securepaynet.net/whoischeck.aspx?domain=KANSASCITYINDEPENDENTFINANCIALADVISOR.COM&prog_id=internetbasedmom
The data contained in this Registrar's Whois database,
while believed by the registrar to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This information
is provided for the sole purpose of assisting you in obtaining
information about domain name registration records. Any use of
this data for any other purpose is expressly forbidden without
the prior written permission of this registrar. By submitting an
inquiry, you agree to these terms of usage and limitations of warranty.
In particular, you agree not to use this data to allow, enable, or
otherwise make possible, dissemination or collection of this data, in
part or in its entirety, for any purpose, such as the transmission of
unsolicited advertising and solicitations of any kind, including spam.
You further agree not to use this data to enable high volume, automated
or robotic electronic processes designed to collect or compile this data
for any purpose, including mining this data for your own personal or
commercial purposes.
Please note: the owner of the domain name is specified in the "registrant" section.
In most cases, the Registrar is not the owner of domain names listed in this database.